U.S. based·Ships from the U.S.·Free shipping over $150·All orders ship within 1 business day·For research use only·
Compound Profiles

TB-500: Research Background, Structure, and Stability

TB-500 is the most-cited synthetic version of thymosin β4 in the research peptide market, marketed under a name that suggests a fragment but actually refers to the full 43-amino-acid sequence. This article walks through what the molecule is at the molecular level, the actin-binding mechanism that drives nearly all of the published preclinical literature, and the stability and handling factors specific to a long, mostly hydrophilic peptide with one oxidation-sensitive residue.

Structural identity

  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids)
  • Molecular formula: C212H350N56O78S
  • Average mass: 4960.51 g/mol
  • Origin: Synthetic. The sequence is identical to full-length thymosin β4 (Tβ4), originally isolated by Allan Goldstein and colleagues in 1981 from bovine thymic extracts.
TB-500 · 43 AMINO ACIDS · DOMAIN MAP N M6 oxidation sensitive LKKTETQ residues 17–23 actin-binding heptapeptide C 1 10 20 30 40 43 Position (N → C)
Figure 1Domain map of TB-500. The 43-amino-acid sequence is identical to full-length thymosin β4. Two features dominate the chemistry of routine handling: the single methionine at position 6, the molecule's only oxidation-sensitive residue; and the central LKKTETQ heptapeptide at residues 17–23 — the actin-binding motif identified across the published Tβ4 literature.

Two structural features matter more than the rest for practical research use. The first is the central LKKTETQ heptapeptide at residues 17–23, the actin-binding motif identified across the Tβ4 mechanism literature. The second is the single methionine at position 6, the molecule's only oxidation-sensitive residue and the reason TB-500 is more handling-sensitive than its general hydrophilicity would suggest. The sequence contains no cysteine, no tryptophan, and no tyrosine, so disulfide chemistry, photolysis, and aromatic-residue side reactions are not in play.

Is TB-500 the same as thymosin β4?

Yes, with one caveat about naming. The 43-amino-acid sequence sold as TB-500 in research peptide catalogs is identical to full-length thymosin β4. The "TB-500" designation comes from an early developmental program; it was never the name of a chemical fragment. Older marketing copy sometimes describes TB-500 as the "active fragment" of thymosin β4, conflating the full peptide with its much shorter actin-binding motif (LKKTETQ). The shorter motif is a research tool in its own right, but it is not what arrives in a vial labeled TB-500.

The practical implication is that the Tβ4 literature — across actin biology, angiogenesis, wound-healing, and cardiac repair models — directly informs TB-500 research design. Cross-referencing studies by their "Tβ4," "thymosin β4," or "thymosin beta-4" titles will surface most of the relevant primary literature; the "TB-500" string alone is a much narrower index term and misses substantial earlier work.

The actin-binding mechanism

Thymosin β4 is the most abundant member of the β-thymosin family in mammalian cells and the primary intracellular sequester of monomeric (G) actin. Each Tβ4 molecule binds one G-actin in 1:1 stoichiometry through the central LKKTETQ motif, preventing the monomer from polymerizing into filamentous (F) actin until it is released. This sequestration role is the foundational mechanism for everything downstream.

Downstream effects characterized in the literature include:

  • Cell migration. Modulation of the G/F actin pool regulates the cytoskeletal rearrangements that drive directed cell movement, particularly in fibroblasts, endothelial cells, and keratinocytes.
  • Angiogenesis. Endothelial cell migration and vascular network formation in chick chorioallantoic membrane and Matrigel assays are both Tβ4-responsive, with the Bock-Marquette / Srivastava cardiac repair work in the mid-2000s establishing this in vivo.
  • Inflammation modulation. Anti-inflammatory effects are reported in animal models of corneal injury, dermal wound healing, and ischemia-reperfusion, mediated in part through interactions with the PINCH-ILK-α-parvin complex and the NF-κB axis.
  • Tβ4 sulfoxide chemistry. The oxidized form of Tβ4, bearing methionine sulfoxide at position 6, has its own distinct biological profile in inflammation models — separate from the reduced parent. This is one of the few peptides where the oxidized variant has been characterized as a distinct entity rather than dismissed as a degradation product.

Published research scope

The thymosin β4 literature is older and broader than most research peptides. Four research areas account for the bulk of citations:

  • Cardiac repair. Bock-Marquette and Srivastava (2004) characterized cardiac regeneration in murine ischemia models, including epicardial cell activation and coronary vessel formation. This is the most-cited single body of Tβ4 work.
  • Dermal repair. A substantial body of rodent and rabbit dermal wound-healing studies, including diabetic and steroid-impaired wound models. Standard endpoints include reepithelialization rate, granulation thickness, and tensile strength.
  • Corneal injury. Sosne and colleagues characterized epithelial repair in rat and rabbit corneal abrasion and chemical-injury models from the early 2000s onward.
  • Equine veterinary research. Tβ4 / TB-500 has a substantial body of veterinary literature in equine soft-tissue injury and is on the banned-substance list of most major racing authorities (FEI, ARCI, USEF). The human-clinical and veterinary literatures overlap heavily and researchers should flag the distinction when citing.

Human clinical-trial data are limited; a few completed phase 1/2 studies cover dermal repair and corneal indications. The bulk of the evidence base is preclinical. Researchers comparing the TB-500 and BPC-157 literatures should note the substantial endpoint overlap in tendon and dermal models alongside the mechanistic divergence — covered in our BPC-157 and TB-500 comparison.

Stability and handling for a 43-mer

At 43 residues, TB-500 is longer than the great majority of peptides in routine research use. Length itself drives two specific handling concerns: increased susceptibility to aggregation at the air-water interface, and a wider range of conformational states in solution than a short peptide samples. Neither is a stability problem per se. Both are reasons to be especially careful with reconstitution and storage.

Manufacturer-stated stability for sealed lyophilized vials:

  • Refrigerated (2–8°C): 24 months is the standard industry-published spec.
  • Frozen (−20°C): 36+ months. This is the research-archive storage temperature.

Reconstituted in bacteriostatic water and refrigerated, working stocks are typically stable for 14–28 days; the standard 28-day BAC water multi-use window applies. The compound is highly water-soluble — the sequence is dominated by charged residues (K, D, E, Q) with very few hydrophobic residues — and reaches working concentrations of 5+ mg/mL without difficulty. The broader storage framework is covered in our storage and stability article.

The aggregation watch-out: longer peptides are more prone to forming higher-order aggregates at the air-water interface. This is the chemistry behind the universal "no shaking" rule, and it matters more for TB-500 than for shorter compounds. Gentle inversion or swirling only — see the reconstitution guide for the full protocol — and minimize headspace agitation across withdrawals from a multi-use vial.

Methionine oxidation: the one residue to watch

Methionine at position 6 is TB-500's single oxidation-prone residue. Oxidation produces methionine sulfoxide and converts the molecule to "Tβ4 sulfoxide," a structurally distinct species with its own biological profile rather than just a degradation product. From a research perspective this matters two ways: the reduced and oxidized forms have different activities in inflammation models, and the conversion can happen slowly during routine storage if vials are repeatedly opened and exposed to atmospheric oxygen.

Three practical countermeasures:

  • Keep vials sealed. Lyophilized vials ship under inert headspace; the protective effect lasts until the stopper is first punctured. After reconstitution, atmospheric oxygen is in contact with the solution and the methionine oxidation clock starts.
  • Refrigerate immediately after reconstitution. Oxidation kinetics slow roughly 2-fold per 10°C drop. The same logic that drives cold storage for hydrolysis applies here.
  • Read the CoA carefully. A lot's release-test HPLC chromatogram will sometimes show a small early-eluting peak corresponding to methionine sulfoxide; this peak can grow over time as a sentinel for accumulated oxidation. Every lot we release ships with its own chromatogram in our open CoA library, and the CoA reading guide walks through the visual cues.

Reconstitution notes specific to TB-500

The standard reconstitution protocol applies unchanged: bacteriostatic water against the glass wall, gentle swirl, refrigerate immediately. Three specifics are worth flagging for a 43-mer:

  1. Dissolution is fast. The high charge density and absence of hydrophobic clustering mean TB-500 dissolves in seconds to a clear, colorless solution. If a vial appears to dissolve slowly, the diluent stream probably hit the cake directly and aerosolized material onto the stopper.
  2. The solution should be colorless. Unlike GHK-Cu, where color is an analytical signal of complex integrity, TB-500 has no visible chromophore. Both the lyophilized cake and the reconstituted solution should be white-to-colorless. Any color in the reconstituted solution is a red flag and should be investigated against the lot's release-test data.
  3. Aliquot generously for long studies. The combination of length-driven aggregation and methionine oxidation makes TB-500 more freeze-thaw sensitive than the typical short peptide. Aliquoting a 10 mg reconstituted vial into ten 1 mg single-use portions, frozen at −20°C, is the standard approach for studies spanning more than a few weeks.

Common analytical and handling issues

HPLC and the methionine sulfoxide peak

TB-500 on RP-HPLC elutes as a single dominant peak with retention behavior typical of a moderately hydrophilic peptide. A small earlier-eluting shoulder or peak in older lots is most often methionine sulfoxide; the chemistry is well-characterized and the release-test chromatogram is the reference. A growing sulfoxide peak across multiple lots from the same vendor suggests systematic storage or formulation problems upstream of delivery.

Mass spectrometry

Theoretical average mass for TB-500 is 4960.51 g/mol. On ESI-MS the molecule typically appears as multiply-charged ions ([M+3H]3+, [M+4H]4+, [M+5H]5+), and the deconvoluted mass should match within standard tolerances. Oxidized material shows a characteristic +16 Da increment per methionine sulfoxide; a single +16 peak is the diagnostic signature of partial M6 oxidation.

The "active fragment" question

Older literature occasionally equates TB-500 with the LKKTETQ heptapeptide alone. The two are not equivalent research tools. The full 43-mer carries additional sequence context that contributes to solubility, conformational dynamics, and downstream signaling that the isolated heptapeptide does not reproduce. Studies built on the isolated motif do not directly translate to studies using full TB-500, or vice versa, and should be cited as distinct research tools.

GLOW blend considerations

Our GLOW blend combines TB-500 with BPC-157 and GHK-Cu in a single lyophilized vial. The blend's stability rules are set by the most-sensitive component — in this case GHK-Cu, which has the narrowest pH and reducing-agent window. TB-500 itself is more robust than that constraint suggests, but in a blend the strictest envelope wins.

Common errors to avoid:

  • Shaking the vial to speed up dissolution. Increases the air-water interface and drives aggregation. Always swirl.
  • Leaving reconstituted vials at room temperature. Methionine oxidation accelerates measurably above ~10°C. Refrigerate promptly after every use.
  • Confusing TB-500 with the LKKTETQ heptapeptide. Different research tools; cite carefully and do not transfer dose conventions between them.
  • Repeated freeze-thaw of one reconstituted vial. Aliquot first, thaw single portions. This is the single largest preventable cause of degradation in TB-500 stocks.
  • Cross-referencing veterinary literature without flagging it. The equine soft-tissue work is well-developed but uses dosing and endpoint conventions that do not translate to non-equine research design.

Where to find primary literature

PubMed indexes nearly all TB-500 / thymosin β4 work. Search terms "thymosin beta 4", "Tβ4", and "TB4 OR TB-500" together cover almost all of it; the "TB-500" string alone misses substantial earlier work indexed under the formal protein name. The Goldstein laboratory's body of early characterization work, the Sosne corneal-injury series, and the Bock-Marquette / Srivastava cardiac papers form the three primary entry points. The 2010 review by Goldstein, Hannappel and Kleinman in Vitamins and Hormones is a useful synthesis through the late 2000s.

For Research Use Only. The information on this page is a summary of published scientific literature provided for laboratory and educational reference. Nothing here is medical advice, a treatment claim, or a dosing recommendation. The compounds discussed have not been evaluated by the FDA and are not intended to diagnose, treat, cure, or prevent any disease. See our RUO Policy.
Added to cart

Are you 21 or older?

This site contains research materials. By entering, you confirm you are 21+ and accept our Terms & RUO disclaimer.